Product Name: SUR1 and SUR2B Monoclonal Antibody: ATTO 680
Description: Mouse Anti-Rat SUR1 and SUR2B Monoclonal IgG1
Target: SUR1/SUR2B
Conjugate: ATTO 680
Product Category: Monoclonal Antibodies
Immunogen: Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B
Host: Mouse
Isotype: IgG1
Form: Purified, in PBS pH7.4, 50% glycerol, 0.09% sodium azide
CAS NO: 861393-28-4
Product: A-740003
Applications: WB, ICC/IF
Reactivity: Mouse, Rat
Working Dilution: WB (1:1000), IHC (1:1000), ICC/IF (1:100); optimal dilutions for assays should be determined by the user.
Concentration: 1 mg/ml
Storage: -20_C
Species:
Synonyms:
Background: Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are sub
Molecular Weight:
Purity:
Image Description:
PubMed ID:http://aac.asm.org/content/51/9/3282.abstract
HIV gp120-CD4 gp120-cd4.com
Just another WordPress site